SCOPe 2.07: Domain d1vtzy_: 1vtz y:

Lineage for d1vtzy_ (1vtz y:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.7: Satellite viruses [88650] (1 family)

5. Family b.121.7.1: Satellite viruses [88651] (3 proteins)

6. Protein STNV coat protein [49621] (1 species)

7. Species Satellite tobacco necrosis virus [TaxId:12881] [49622] (8 PDB entries)

8. Domain d1vtzy_: 1vtz y: [197614]
   Other proteins in same PDB: d1vtz5_, d1vtz7_, d1vtzk_
   complexed with ca
   complexed with ca

Details for d1vtzy_

PDB Entry: 1vtz, 1.45 Å

PDB Description: 1.45 Angstrom Structure of STNV coat protein (half of the capsid, the other half in PDB 3RQV)

PDB Compounds: (y:) coat protein

SCOPe Domain Sequences for d1vtzy_:

Sequence; same for both SEQRES and ATOM records:

>d1vtzy_ b.121.7.1 (y:) STNV coat protein {Satellite tobacco necrosis virus [TaxId: 12881]}
tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
ytda

Timeline for d1vtzy_:

• d1vtzy_ first appeared in SCOPe 2.03
  
• d1vtzy_ appears in SCOPe 2.06
  
• d1vtzy_ appears in the current release, SCOPe 2.08