Lineage for d3sh7a_ (3sh7 A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690477Protein beta-Lactamase, class A [56606] (16 species)
  7. 1690478Species Bacillus licheniformis [TaxId:1402] [56612] (11 PDB entries)
  8. 1690497Domain d3sh7a_: 3sh7 A: [197443]
    automated match to d3ly3a_
    complexed with bb0

Details for d3sh7a_

PDB Entry: 3sh7 (more details), 2.5 Å

PDB Description: Crystal structure of fluorophore-labeled beta-lactamase PenP
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3sh7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sh7a_ e.3.1.1 (A:) beta-Lactamase, class A {Bacillus licheniformis [TaxId: 1402]}
kddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedln
qritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkel
rkigdevtnperfcpelnevnpgetqdtstaralvtslrafaledklpsekrellidwmk
rnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdaky
ddkliaeatkvvmkaln

SCOPe Domain Coordinates for d3sh7a_:

Click to download the PDB-style file with coordinates for d3sh7a_.
(The format of our PDB-style files is described here.)

Timeline for d3sh7a_: