Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins) |
Protein CD2, first domain [48740] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries) |
Domain d1cdb__: 1cdb - [19744] |
PDB Entry: 1cdb (more details)
SCOP Domain Sequences for d1cdb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdb__ b.1.1.1 (-) CD2, first domain {Human (Homo sapiens)} keitnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdty klfkngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqer
Timeline for d1cdb__: