SCOP 1.67: Domain d1cdb__: 1cdb -

Lineage for d1cdb__ (1cdb -)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein CD2, first domain [48740] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries)

8. Domain d1cdb__: 1cdb - [19744]

Details for d1cdb__

PDB Entry: 1cdb

PDB Description: structure of the glycosylated adhesion domain of human t lymphocyte glycoprotein cd2

SCOP Domain Sequences for d1cdb__:

Sequence; same for both SEQRES and ATOM records:

>d1cdb__ b.1.1.1 (-) CD2, first domain {Human (Homo sapiens)}
keitnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdty
klfkngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqer

Timeline for d1cdb__:

• d1cdb__ first appeared (with stable ids) in SCOP 1.55
  
• d1cdb__ appears in SCOP 1.65
  
• d1cdb__ appears in SCOP 1.69
  
• d1cdb__ appears in the current release, SCOPe 2.08, called d1cdba_