Lineage for d4hrwa_ (4hrw A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1627984Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 1627985Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 1628060Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 1628090Protein Putative deaminase NE0047 [142833] (1 species)
  7. 1628091Species Nitrosomonas europaea [TaxId:915] [142834] (9 PDB entries)
    Uniprot Q82Y41 1-189
  8. 1628104Domain d4hrwa_: 4hrw A: [197391]
    automated match to d2g84a1
    complexed with azg, zn

Details for d4hrwa_

PDB Entry: 4hrw (more details), 2.43 Å

PDB Description: identification of function and mechanistic insights of guanine deaminase from nitrosomonas europaea
PDB Compounds: (A:) Cytidine and deoxycytidylate deaminase zinc-binding region

SCOPe Domain Sequences for d4hrwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hrwa_ c.97.1.2 (A:) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]}
mndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsgll
iaagtnrvvpgrcsaahaailalslaqakldthdlsadglpacelvtsaepcvmcfgavi
wsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreynac
ngviynarc

SCOPe Domain Coordinates for d4hrwa_:

Click to download the PDB-style file with coordinates for d4hrwa_.
(The format of our PDB-style files is described here.)

Timeline for d4hrwa_: