Lineage for d4f2wa_ (4f2w A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2496449Protein automated matches [190142] (20 species)
    not a true protein
  7. 2496565Species Salmonella enterica [TaxId:904139] [196952] (5 PDB entries)
  8. 2496574Domain d4f2wa_: 4f2w A: [197376]
    Other proteins in same PDB: d4f2wb2
    automated match to d4g89a_
    complexed with cl, edo, tdi

Details for d4f2wa_

PDB Entry: 4f2w (more details), 2 Å

PDB Description: Crystal structure of 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Salmonella enterica with methyl-thio-DADMe-Immucillin-A
PDB Compounds: (A:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d4f2wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f2wa_ c.56.2.1 (A:) automated matches {Salmonella enterica [TaxId: 904139]}
mkigiigameeevtllrdkidnrqtitlggceiytgqlngtevallksgigkvaaalgat
lllehckpdviintgsagglastlkvgdivvsdetryhdadvtafgyeygqlpgcpagfk
addkliaaaescirelnlnavrglivsgdafingsvglakirhnfpdavavemeataiah
vchnfnvpfvvvraisdvadqqshlsfdeflavaakqstlmvetlvqklah

SCOPe Domain Coordinates for d4f2wa_:

Click to download the PDB-style file with coordinates for d4f2wa_.
(The format of our PDB-style files is described here.)

Timeline for d4f2wa_: