SCOPe 2.02: Domain d4in7m_: 4in7 M:

Lineage for d4in7m_ (4in7 M:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (5 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (37 PDB entries)

8. Domain d4in7m_: 4in7 M: [197253]
   Other proteins in same PDB: d4in7l_
   automated match to d2j8dm_
   complexed with bcl, bph, cdl, fe, ggd, gol, hto, k, lda, mg, pc1, po4, spo, u10; mutant

Details for d4in7m_

PDB Entry: 4in7, 2.85 Å

PDB Description: (m)l214n mutant of the rhodobacter sphaeroides reaction center

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d4in7m_:

Sequence; same for both SEQRES and ATOM records:

>d4in7m_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsanlfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d4in7m_:

• d4in7m_ is new in SCOPe 2.02-stable
  
• d4in7m_ appears in SCOPe 2.03
  
• d4in7m_ appears in the current release, SCOPe 2.08