Lineage for d4iwna_ (4iwn A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1611971Family c.66.1.14: Hypothetical protein HI0319 (YecO) [69544] (2 proteins)
  6. 1611976Protein automated matches [197190] (2 species)
    not a true protein
  7. 1611980Species Escherichia coli [TaxId:562] [197191] (1 PDB entry)
  8. 1611981Domain d4iwna_: 4iwn A: [197250]
    automated match to d1im8a_
    protein/RNA complex; complexed with gek, mpd

Details for d4iwna_

PDB Entry: 4iwn (more details), 1.73 Å

PDB Description: Crystal structure of a putative methyltransferase CmoA in complex with a novel SAM derivative
PDB Compounds: (A:) tRNA (cmo5U34)-methyltransferase

SCOPe Domain Sequences for d4iwna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iwna_ c.66.1.14 (A:) automated matches {Escherichia coli [TaxId: 562]}
tfdervaevfpdmiqrsvpgysniismigmlaerfvqpgtqvydlgcslgaatlsvrrni
hhdnckiiaidnspamiercrhhidaykaptpvdviegdirdiaienasmvvlnftlqfl
epserqalldkiyqglnpggalvlsekfsfedakvgellfnmhhdfkrangyseleisqk
rsmlenvmltdsvethkarlhnagfehselwfqcfnfgslvalkaedaa

SCOPe Domain Coordinates for d4iwna_:

Click to download the PDB-style file with coordinates for d4iwna_.
(The format of our PDB-style files is described here.)

Timeline for d4iwna_: