Lineage for d4g2ja_ (4g2j A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1101761Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1101762Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1101839Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1101989Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (1 species)
  7. 1101990Species Human (Homo sapiens) [TaxId:9606] [109943] (14 PDB entries)
    Uniprot O76083 241-566
  8. 1102001Domain d4g2ja_: 4g2j A: [197157]
    automated match to d3dy8a_
    complexed with 0wf, mg, zn

Details for d4g2ja_

PDB Entry: 4g2j (more details), 2.4 Å

PDB Description: Human pde9 in complex with selective compound
PDB Compounds: (A:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d4g2ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g2ja_ a.211.1.2 (A:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
gshmtypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrr
wlfcvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhp
gynntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmi
tlilatdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwv
dclleeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmvee
imlqplwesrdryeelkriddamkelqk

SCOPe Domain Coordinates for d4g2ja_:

Click to download the PDB-style file with coordinates for d4g2ja_.
(The format of our PDB-style files is described here.)

Timeline for d4g2ja_: