![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.12: Pirin-like [101984] (2 proteins) Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin |
![]() | Protein Pirin [101985] (1 species) Bcl-3 and nuclear factor I-interacting protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101986] (13 PDB entries) |
![]() | Domain d4ewea_: 4ewe A: [197151] automated match to d1j1la_ complexed with edo, mn |
PDB Entry: 4ewe (more details), 1.56 Å
SCOPe Domain Sequences for d4ewea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ewea_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} sskkvtlsvlsreqsegvgarvrrsigrpelknldpfllfdefkggrpggfpdhphrgfe tvsylleggsmahedfcghtgkmnpgdlqwmtagrgilhaempcseepahglqlwvnlrs sekmvepqyqelkseeipkpskdgvtvavisgealgikskvytrtptlyldfkldpgakh sqpipkgwtsfiytisgdvyigpddaqqkiephhtavlgegdsvqvenkdpkrshfvlia geplrepviqhgpfvmntneeisqaildfrnakngferaktwkskign
Timeline for d4ewea_: