SCOPe 2.06: Domain d4kefa1: 4kef A:2-139

Lineage for d4kefa1 (4kef A:2-139)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.2: Cofilin-like [55762] (8 proteins)

6. Protein automated matches [190045] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [197113] (3 PDB entries)

8. Domain d4kefa1: 4kef A:2-139 [197115]
   Other proteins in same PDB: d4kefa2
   automated match to d1cofa_
   mutant

Details for d4kefa1

PDB Entry: 4kef, 1.1 Å

PDB Description: Structure of Cofilin Mutant (cof1-159p)

PDB Compounds: (A:) cofilin

SCOPe Domain Sequences for d4kefa1:

Sequence, based on SEQRES records:

>d4kefa1 d.109.1.2 (A:2-139) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
srsgvavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpend
clyaiydfeyeingnegkrsdivfftwspdtapvrskmvyasskdalrralngvstdvqg
tdfsevsydsvlervsrg

Sequence, based on observed residues (ATOM records):

>d4kefa1 d.109.1.2 (A:2-139) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
srsgvavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpend
clyaiydfeyekrsdivfftwspdtapvrskmvyasskdalrralngvstdvqgtdfsev
sydsvlervsrg

Timeline for d4kefa1:

• d4kefa1 first appeared in SCOPe 2.02, called d4kefa_
  
• d4kefa1 was called d4kefa_ in SCOPe 2.05
  
• d4kefa1 appears in SCOPe 2.07
  
• d4kefa1 appears in the current release, SCOPe 2.08