SCOPe 2.04: Domain d4kefa_: 4kef A:

Lineage for d4kefa_ (4kef A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.2: Cofilin-like [55762] (8 proteins)

6. Protein automated matches [190045] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [197113] (3 PDB entries)

8. Domain d4kefa_: 4kef A: [197115]
   automated match to d1cofa_
   mutant

Details for d4kefa_

PDB Entry: 4kef, 1.1 Å

PDB Description: Structure of Cofilin Mutant (cof1-159p)

PDB Compounds: (A:) cofilin

SCOPe Domain Sequences for d4kefa_:

Sequence, based on SEQRES records:

>d4kefa_ d.109.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrsgvavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpen
dclyaiydfeyeingnegkrsdivfftwspdtapvrskmvyasskdalrralngvstdvq
gtdfsevsydsvlervsrg

Sequence, based on observed residues (ATOM records):

>d4kefa_ d.109.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrsgvavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpen
dclyaiydfeyekrsdivfftwspdtapvrskmvyasskdalrralngvstdvqgtdfse
vsydsvlervsrg

Timeline for d4kefa_:

• d4kefa_ first appeared in SCOPe 2.02
  
• d4kefa_ appears in SCOPe 2.03
  
• d4kefa_ appears in SCOPe 2.05
  
• d4kefa_ appears in the current release, SCOPe 2.08, called d4kefa1