![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
![]() | Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
![]() | Protein automated matches [190045] (5 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [197113] (3 PDB entries) |
![]() | Domain d4kefa_: 4kef A: [197115] automated match to d1cofa_ mutant |
PDB Entry: 4kef (more details), 1.1 Å
SCOPe Domain Sequences for d4kefa_:
Sequence, based on SEQRES records: (download)
>d4kefa_ d.109.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrsgvavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpen dclyaiydfeyeingnegkrsdivfftwspdtapvrskmvyasskdalrralngvstdvq gtdfsevsydsvlervsrg
>d4kefa_ d.109.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrsgvavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpen dclyaiydfeyekrsdivfftwspdtapvrskmvyasskdalrralngvstdvqgtdfse vsydsvlervsrg
Timeline for d4kefa_: