Lineage for d4isoa_ (4iso A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1546139Protein Matriptase MTSP1 [69284] (1 species)
  7. 1546140Species Human (Homo sapiens) [TaxId:9606] [69285] (18 PDB entries)
  8. 1546146Domain d4isoa_: 4iso A: [197098]
    Other proteins in same PDB: d4isob_
    automated match to d1eaxa_
    complexed with gol, gsh, peg, pge

Details for d4isoa_

PDB Entry: 4iso (more details), 2.01 Å

PDB Description: crystal structure of matriptase in complex with its inhibitor hai-1
PDB Compounds: (A:) Suppressor of tumorigenicity 14 protein

SCOPe Domain Sequences for d4isoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4isoa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]}
vvggtdadegewpwqvslhalgqghicgaslispnwlvsaahcyiddrgfrysdptqwta
flglhdqsqrsapgvqerrlkriishpffndftfdydiallelekpaeyssmvrpiclpd
ashvfpagkaiwvtgwghtqyggtgalilqkgeirviqqttcenllpqqitprmmcvgfl
sggvdscqgdsggplssveadgrifqagvvswgdgcaqrnkpgvytrlplfrdwikentg
v

SCOPe Domain Coordinates for d4isoa_:

Click to download the PDB-style file with coordinates for d4isoa_.
(The format of our PDB-style files is described here.)

Timeline for d4isoa_: