Lineage for d4as7a_ (4as7 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1595736Family c.37.1.9: Motor proteins [52641] (5 proteins)
  6. 1595877Protein automated matches [190129] (6 species)
    not a true protein
  7. 1595886Species Human (Homo sapiens) [TaxId:9606] [187145] (31 PDB entries)
  8. 1595907Domain d4as7a_: 4as7 A: [197073]
    automated match to d2gm1d_
    complexed with 6lx, adp, cd, cl, co

Details for d4as7a_

PDB Entry: 4as7 (more details), 2.4 Å

PDB Description: Eg5 complex 1
PDB Compounds: (A:) Kinesin-like protein KIF11

SCOPe Domain Sequences for d4as7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4as7a_ c.37.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgas
tkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedpldgi
iprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvi
ikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeel
vkigklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphvpyresk
ltrilqdslggrtrtsiiatispaslnleetlstleyahraknilnkpe

SCOPe Domain Coordinates for d4as7a_:

Click to download the PDB-style file with coordinates for d4as7a_.
(The format of our PDB-style files is described here.)

Timeline for d4as7a_: