SCOPe 2.06: Domain d3zk6a_: 3zk6 A:

Lineage for d3zk6a_ (3zk6 A:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (49 PDB entries)

8. Domain d3zk6a_: 3zk6 A: [197062]
   automated match to d1g5ja_
   complexed with h1i

Details for d3zk6a_

PDB Entry: 3zk6, 2.48 Å

PDB Description: Crystal structure of Bcl-xL in complex with inhibitor (Compound 2).

PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d3zk6a_:

Sequence, based on SEQRES records:

>d3zk6a_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqsnrelvvdflsyklsqkgyswsqfsdveenrteapegipmaavkqalreagdefelry
rrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqv
lvsriaawmatylndhlepwiqenggwdtfvelygn

Sequence, based on observed residues (ATOM records):

>d3zk6a_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqsnrelvvdflsyklsqkgyswsqfsipmaavkqalreagdefelryrrafsdltsqlh
itpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmaty
lndhlepwiqenggwdtfvelygn

Timeline for d3zk6a_:

• d3zk6a_ first appeared in SCOPe 2.02
  
• d3zk6a_ appears in SCOPe 2.05
  
• d3zk6a_ appears in SCOPe 2.07
  
• d3zk6a_ appears in the current release, SCOPe 2.08, called d3zk6a1