Lineage for d3vzja_ (3vzj A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119317Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 1119362Protein Xylanase II [49979] (17 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 1119385Species Bacillus circulans [TaxId:1397] [49980] (16 PDB entries)
  8. 1119402Domain d3vzja_: 3vzj A: [197049]
    automated match to d1xnba_
    complexed with so4; mutant

Details for d3vzja_

PDB Entry: 3vzj (more details), 2.41 Å

PDB Description: Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) E172H mutant
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3vzja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vzja_ b.29.1.11 (A:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmathgyqssgss
nvtvw

SCOPe Domain Coordinates for d3vzja_:

Click to download the PDB-style file with coordinates for d3vzja_.
(The format of our PDB-style files is described here.)

Timeline for d3vzja_: