SCOP 1.69: Domain d1neu__: 1neu -

Lineage for d1neu__ (1neu -)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Myelin membrane adhesion molecule P0 [48728] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48729] (1 PDB entry)

8. Domain d1neu__: 1neu - [19704]

Details for d1neu__

PDB Entry: 1neu, 1.9 Å

PDB Description: structure of myelin membrane adhesion molecule p0

SCOP Domain Sequences for d1neu__:

Sequence, based on SEQRES records:

>d1neu__ b.1.1.1 (-) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus)}
ivvytdrevygavgsqvtlhcsfwssewvsddisftwryqpeggrdaisifhyakgqpyi
devgtfkeriqwvgdpswkdgsivihnldysdngtftcdvknppdivgktsqvtlyvfe

Sequence, based on observed residues (ATOM records):

>d1neu__ b.1.1.1 (-) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus)}
ivvytdrevygavgsqvtlhcsfwssewvsddisftwryqpeggrdaisifhyakgqpyi
devgtfkeriqwvgdpswkdgsivihnldysdngtftcdvknvgktsqvtlyvfe

Timeline for d1neu__:

• d1neu__ first appeared (with stable ids) in SCOP 1.55
  
• d1neu__ appears in SCOP 1.67
  
• d1neu__ appears in SCOP 1.71
  
• d1neu__ appears in the current release, SCOPe 2.08, called d1neua_