SCOPe 2.08: Domain d4iyea1: 4iye A:1-65

Lineage for d4iyea1 (4iye A:1-65)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
   automatically mapped to Pfam PF00087

6. Protein automated matches [190676] (9 species)
   not a true protein

7. Species Green mamba (Dendroaspis angusticeps) [TaxId:8618] [197029] (2 PDB entries)

8. Domain d4iyea1: 4iye A:1-65 [197030]
   Other proteins in same PDB: d4iyea2
   automated match to d1ff4a_
   complexed with edo, peg

Details for d4iyea1

PDB Entry: 4iye, 1.95 Å

PDB Description: Crystal structure of AdTx1 (rho-Da1a) from eastern green mamba (Dendroaspis angusticeps)

PDB Compounds: (A:) Toxin AdTx1

SCOPe Domain Sequences for d4iyea1:

Sequence; same for both SEQRES and ATOM records:

>d4iyea1 g.7.1.1 (A:1-65) automated matches {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]}
ltcvtsksifgittedcpdgqnlcfkrrhyvvpaiydstrgcaatcpipenydsihcckt
dkcne

Timeline for d4iyea1:

• d4iyea1 first appeared in SCOPe 2.02, called d4iyea_
  
• d4iyea1 appears in SCOPe 2.07