| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) ![]() duplication: contains multiple CxxCH motifs |
| Family a.138.1.3: Di-heme elbow motif [48711] (6 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
| Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species) |
| Species Shewanella putrefaciens [TaxId:24] [48723] (3 PDB entries) |
| Domain d1d4da1: 1d4d A:4-102 [19702] Other proteins in same PDB: d1d4da2, d1d4da3 |
PDB Entry: 1d4d (more details), 2.5 Å
SCOP Domain Sequences for d1d4da1:
Sequence, based on SEQRES records: (download)
>d1d4da1 a.138.1.3 (A:4-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella putrefaciens}
vladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsphksh
ligeiactschkgheksvaycdachsfgfdmpfggkwer
>d1d4da1 a.138.1.3 (A:4-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella putrefaciens}
vladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapvsphkshlig
eiactschkgheksvaycdachsfgfdmpfggkwer
Timeline for d1d4da1: