SCOPe 2.04: Domain d4ga3a_: 4ga3 A:

Lineage for d4ga3a_ (4ga3 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein automated matches [190489] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187688] (47 PDB entries)

8. Domain d4ga3a_: 4ga3 A: [197013]
   automated match to d2f89f_
   complexed with 4ga, mg, po4

Details for d4ga3a_

PDB Entry: 4ga3, 2.39 Å

PDB Description: Crystal Structure of Human Farnesyl Diphosphate Synthase in Complex with BPH-1260

PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d4ga3a_:

Sequence; same for both SEQRES and ATOM records:

>d4ga3a_ a.128.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
ldlpavflqyeedsyshimalieqyaaplppavflglarkiykrrk

Timeline for d4ga3a_:

• d4ga3a_ first appeared in SCOPe 2.02
  
• d4ga3a_ appears in SCOPe 2.03
  
• d4ga3a_ appears in SCOPe 2.05
  
• d4ga3a_ appears in the current release, SCOPe 2.08