SCOPe 2.07: Domain d4doma1: 4dom A:157-296

Lineage for d4doma1 (4dom A:157-296)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families)

5. Family c.23.2.0: automated matches [196997] (1 protein)
   not a true family

6. Protein automated matches [196998] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196999] (8 PDB entries)

8. Domain d4doma1: 4dom A:157-296 [197000]
   Other proteins in same PDB: d4doma2
   automated match to d1fywa_

Details for d4doma1

PDB Entry: 4dom, 1.8 Å

PDB Description: crystal structure of the tir-domain of human myeloid differentiation primary response protein (myd88)

PDB Compounds: (A:) Myeloid differentiation primary response protein MyD88

SCOPe Domain Sequences for d4doma1:

Sequence; same for both SEQRES and ATOM records:

>d4doma1 c.23.2.0 (A:157-296) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mperfdaficycpsdiqfvqemirqleqtnyrlklcvsdrdvlpgtcvwsiaseliekrc
rrmvvvvsddylqskecdfqtkfalslspgahqkrlipikykamkkefpsilrfitvcdy
tnpctkswfwtrlakalslp

Timeline for d4doma1:

• d4doma1 first appeared in SCOPe 2.02, called d4doma_
  
• d4doma1 appears in SCOPe 2.06
  
• d4doma1 appears in the current release, SCOPe 2.08