Lineage for d1fs9a_ (1fs9 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544896Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 544897Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 544980Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 544981Protein Cytochrome c nitrite reductase [48718] (4 species)
  7. 544994Species Wolinella succinogenes [TaxId:844] [48720] (3 PDB entries)
  8. 544997Domain d1fs9a_: 1fs9 A: [19693]
    complexed with azi, ca, hem, y1

Details for d1fs9a_

PDB Entry: 1fs9 (more details), 2 Å

PDB Description: cytochrome c nitrite reductase from wolinella succinogenes-azide complex

SCOP Domain Sequences for d1fs9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs9a_ a.138.1.3 (A:) Cytochrome c nitrite reductase {Wolinella succinogenes}
ktahsqgiegkamseewaryyprqfdswkktkesdnitdmlkekpalvvawagypfskdy
naprghyyalqdnintlrtgapvdgktgplpsacwtckspdvpriieqdgeleyftgkwa
kygdeivntigcynchddksaelkskvpyldrglsaagfktfaesthqekrslvcaqchv
eyyfkktewkddkgvdktamvvtlpwskgisteqmeayydeinfadwthgisktpmlkaq
hpdwelyktgihgqkgvscadchmpytqegavkysdhkvgnpldnmdkscmnchreseqk
lkdivkqkferkeflqdiafdnigkahletgkamelgatdaelkeirthirhaqwradma
iaghgsffhapeevlrllasgneeaqkariklvkvlakygaidyvapdfetkekaqklak
vdmeafiaeklkfkqtleqewkkqaiakgrlnpeslkgvdekssyydktkk

SCOP Domain Coordinates for d1fs9a_:

Click to download the PDB-style file with coordinates for d1fs9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fs9a_: