Class a: All alpha proteins [46456] (290 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein Cytochrome c nitrite reductase [48718] (5 species) |
Species Wolinella succinogenes [TaxId:844] [48720] (3 PDB entries) |
Domain d1fs9a_: 1fs9 A: [19693] complexed with azi, ca, hec, y1 |
PDB Entry: 1fs9 (more details), 2 Å
SCOPe Domain Sequences for d1fs9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fs9a_ a.138.1.3 (A:) Cytochrome c nitrite reductase {Wolinella succinogenes [TaxId: 844]} ktahsqgiegkamseewaryyprqfdswkktkesdnitdmlkekpalvvawagypfskdy naprghyyalqdnintlrtgapvdgktgplpsacwtckspdvpriieqdgeleyftgkwa kygdeivntigcynchddksaelkskvpyldrglsaagfktfaesthqekrslvcaqchv eyyfkktewkddkgvdktamvvtlpwskgisteqmeayydeinfadwthgisktpmlkaq hpdwelyktgihgqkgvscadchmpytqegavkysdhkvgnpldnmdkscmnchreseqk lkdivkqkferkeflqdiafdnigkahletgkamelgatdaelkeirthirhaqwradma iaghgsffhapeevlrllasgneeaqkariklvkvlakygaidyvapdfetkekaqklak vdmeafiaeklkfkqtleqewkkqaiakgrlnpeslkgvdekssyydktkk
Timeline for d1fs9a_: