SCOPe 2.02: Domain d4f5mb_: 4f5m B:

Lineage for d4f5mb_ (4f5m B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.1: AAT-like [53384] (17 proteins)

6. Protein automated matches [190317] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [196886] (8 PDB entries)

8. Domain d4f5mb_: 4f5m B: [196893]
   automated match to d1aama_
   complexed with edo

Details for d4f5mb_

PDB Entry: 4f5m, 1.65 Å

PDB Description: Wild-Type E. coli Aspartate Aminotransferase: A Template For The Interconversion of Substrate Specificity and Activity To Tyrosine Aminotransferase By The JANUS Algorithm.

PDB Compounds: (B:) aspartate aminotransferase

SCOPe Domain Sequences for d4f5mb_:

Sequence; same for both SEQRES and ATOM records:

>d4f5mb_ c.67.1.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
gtfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllen
ettknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflaknts
vkrvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhg
cchnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeli
vassysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatils
ndalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvl
rlreefgvyavasgrvnvagmtpdnmaplceaivav

Timeline for d4f5mb_:

• d4f5mb_ is new in SCOPe 2.02-stable
  
• d4f5mb_ appears in SCOPe 2.03
  
• d4f5mb_ appears in the current release, SCOPe 2.08, called d4f5mb1