Lineage for d4gzba_ (4gzb A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2245342Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2245343Protein automated matches [190857] (40 species)
    not a true protein
  7. 2245712Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196777] (16 PDB entries)
  8. 2245716Domain d4gzba_: 4gzb A: [196778]
    automated match to d2wzxa_
    complexed with edo

Details for d4gzba_

PDB Entry: 4gzb (more details), 1.79 Å

PDB Description: Crystal structure of native AmpC beta-lactamase from Pseudomonas aeruginosa PAO1
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4gzba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gzba_ e.3.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
apadrlkalvdaavqpvmkandipglavaislkgephyfsyglaskedgrrvtpetlfei
gsvsktftatlagyaltqdkmrlddrasqhwpalqgsrfdgislldlatytagglplqfp
dsvqkdqaqirdyyrqwqptyapgsqrlysnpsiglfgylaarslgqpferlmeqqvfpa
lgleqthldvpeaalaqyaqgygkddrplrvgpgpldaegygvktsaadllrfvdanlhp
erldrpwaqaldathrgyykvgdmtqglgweaydwpislkrlqagnstpmalqphriarl
papqalegqrllnktgstngfgayvafvpgrdlglvilanrnypnaervkiayailsgle
qqgkvpl

SCOPe Domain Coordinates for d4gzba_:

Click to download the PDB-style file with coordinates for d4gzba_.
(The format of our PDB-style files is described here.)

Timeline for d4gzba_: