Lineage for d4ao5c_ (4ao5 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818270Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2818271Protein automated matches [191182] (20 species)
    not a true protein
  7. 2818279Species Bacillus subtilis [TaxId:1423] [189439] (11 PDB entries)
  8. 2818285Domain d4ao5c_: 4ao5 C: [196733]
    Other proteins in same PDB: d4ao5b2, d4ao5d2, d4ao5e2
    automated match to d2xcea_
    complexed with na, ump

Details for d4ao5c_

PDB Entry: 4ao5 (more details), 1.6 Å

PDB Description: B. subtilis prophage dUTPase YosS in complex with dUMP
PDB Compounds: (C:) spbc2 prophage-derived deoxyuridine 5'-triphosphate nucleo tidohydrolase yoss

SCOPe Domain Sequences for d4ao5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ao5c_ b.85.4.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
dlievdrl

SCOPe Domain Coordinates for d4ao5c_:

Click to download the PDB-style file with coordinates for d4ao5c_.
(The format of our PDB-style files is described here.)

Timeline for d4ao5c_: