SCOPe 2.07: Domain d4eb2a_: 4eb2 A:

Lineage for d4eb2a_ (4eb2 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (9 species)
   not a true protein

7. Species European mistletoe (Viscum album) [TaxId:3972] [188629] (7 PDB entries)

8. Domain d4eb2a_: 4eb2 A: [196710]
   Other proteins in same PDB: d4eb2b1, d4eb2b2
   automated match to d1puma_
   complexed with azi, cl, edo, gol, nag, peg, so4

Details for d4eb2a_

PDB Entry: 4eb2, 1.94 Å

PDB Description: crystal structure mistletoe lectin i from viscum album in complex with n-acetyl-d-glucosamine at 1.94 a resolution.

PDB Compounds: (A:) Beta-galactoside-specific lectin 1 chain A

SCOPe Domain Sequences for d4eb2a_:

Sequence; same for both SEQRES and ATOM records:

>d4eb2a_ d.165.1.1 (A:) automated matches {European mistletoe (Viscum album) [TaxId: 3972]}
yerlslrtvqqttgaeyfsfitllrdfvssgsfsnqipllrqstipvsegqrfvlveltn
aggdsitaaidvtnlyvvayqagrqsyflkdapagaetqdfagttrsslpfngsypdler
yaghrdqiplgidqliasvtalrfpggqtrtqarsililiqmiseaarfnpilwrarqyi
nsgasflpdvymleletswgqqstqvqhstdgvfnnpialalspgsvvtltnvrdviasl
aimlfvcge

Timeline for d4eb2a_:

• d4eb2a_ first appeared in SCOPe 2.02
  
• d4eb2a_ appears in SCOPe 2.06
  
• d4eb2a_ appears in the current release, SCOPe 2.08