![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (17 proteins) |
![]() | Protein automated matches [190465] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189707] (9 PDB entries) |
![]() | Domain d4ijxa_: 4ijx A: [196683] automated match to d1xsba_ complexed with dpo, gol, mg, po4; mutant |
PDB Entry: 4ijx (more details), 2.1 Å
SCOPe Domain Sequences for d4ijxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ijxa_ d.113.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} racgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddletalratqeea gieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayrwlgleeac qlaqfkemkaalqeghqflcsiealeh
Timeline for d4ijxa_: