Lineage for d3zhwa_ (3zhw A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301856Protein automated matches [190359] (44 species)
    not a true protein
  7. 2302105Species Escherichia coli [TaxId:562] [196657] (1 PDB entry)
  8. 2302106Domain d3zhwa_: 3zhw A: [196658]
    automated match to d2oifg_
    complexed with hem, so4

Details for d3zhwa_

PDB Entry: 3zhw (more details), 2.22 Å

PDB Description: X-ray Crystallographic Structural Characteristics of Arabidopsis Hemoglobin I and their Functional Implications
PDB Compounds: (A:) Non-symbiotic hemoglobin 1

SCOPe Domain Sequences for d3zhwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zhwa_ a.1.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
kivfteeqealvvkswsvmkknsaelglklfikifeiapttkkmfsflrdspipaeqnpk
lkphamsvfvmccesavqlrktgkvtvrettlkrlgashskygvvdehfevakyalleti
keavpemwspemkvawgqaydhlvaaikaemnls

SCOPe Domain Coordinates for d3zhwa_:

Click to download the PDB-style file with coordinates for d3zhwa_.
(The format of our PDB-style files is described here.)

Timeline for d3zhwa_: