Lineage for d1f22a_ (1f22 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449456Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 449457Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 449458Family a.138.1.1: Cytochrome c3-like [48696] (4 proteins)
  6. 449497Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species)
    contains three heme groups; deletion of one of Cyt c3 heme-binding sites
  7. 449498Species Desulfuromonas acetoxidans [TaxId:891] [48704] (8 PDB entries)
  8. 449501Domain d1f22a_: 1f22 A: [19665]

Details for d1f22a_

PDB Entry: 1f22 (more details)

PDB Description: a proton-nmr investigation of the fully reduced cytochrome c7 from desulfuromonas acetoxidans. comparison between the reduced and the oxidized forms.

SCOP Domain Sequences for d1f22a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f22a_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5, PpcA) {Desulfuromonas acetoxidans}
advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
kcggchik

SCOP Domain Coordinates for d1f22a_:

Click to download the PDB-style file with coordinates for d1f22a_.
(The format of our PDB-style files is described here.)

Timeline for d1f22a_: