Lineage for d4f0za_ (4f0z A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2603960Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2603961Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2604064Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2604164Protein Protein phosphatase-2B (PP-2B, calcineurin A subunit) [56313] (2 species)
  7. 2604167Species Human (Homo sapiens) [TaxId:9606] [56315] (8 PDB entries)
  8. 2604168Domain d4f0za_: 4f0z A: [196641]
    Other proteins in same PDB: d4f0zb_
    automated match to d1m63a_
    complexed with ca, gol

Details for d4f0za_

PDB Entry: 4f0z (more details), 1.7 Å

PDB Description: Crystal Structure of Calcineurin in Complex with the Calcineurin-Inhibiting Domain of the African Swine Fever Virus Protein A238L
PDB Compounds: (A:) Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform

SCOPe Domain Sequences for d4f0za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f0za_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]}
tdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilr
qeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlyl
walkilypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnq
qflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntv
rgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyld
vynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvln

SCOPe Domain Coordinates for d4f0za_:

Click to download the PDB-style file with coordinates for d4f0za_.
(The format of our PDB-style files is described here.)

Timeline for d4f0za_: