SCOPe 2.02: Domain d4ghib_: 4ghi B:

Lineage for d4ghib_ (4ghi B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187434] (9 PDB entries)

8. Domain d4ghib_: 4ghi B: [196637]
   Other proteins in same PDB: d4ghia_
   automated match to d3h82b_
   complexed with 0x3

Details for d4ghib_

PDB Entry: 4ghi, 1.5 Å

PDB Description: Crystal structure of the high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS domains in complex with a benzoxadiazole antagonist

PDB Compounds: (B:) Aryl hydrocarbon receptor nuclear translocator

SCOPe Domain Sequences for d4ghib_:

Sequence; same for both SEQRES and ATOM records:

>d4ghib_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvvk
lkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvkns

Timeline for d4ghib_:

• d4ghib_ is new in SCOPe 2.02-stable
  
• d4ghib_ appears in SCOPe 2.03
  
• d4ghib_ appears in the current release, SCOPe 2.08