SCOPe 2.02: Domain d4bcya_: 4bcy A:

Lineage for d4bcya_ (4bcy A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein automated matches [190916] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189462] (3 PDB entries)

8. Domain d4bcya_: 4bcy A: [196630]
   automated match to d2xjka_
   complexed with cd, cl, cu, zn; mutant

Details for d4bcya_

PDB Entry: 4bcy

PDB Description: monomeric human cu,zn superoxide dismutase, mutation h43f

PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d4bcya_:

Sequence, based on SEQRES records:

>d4bcya_ b.1.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglfgfhvheeedntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Sequence, based on observed residues (ATOM records):

>d4bcya_ b.1.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglfgfhvheeedagphfnpl
srkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvhekaddlg
kggneestktgnagsrlacgvigiaq

Timeline for d4bcya_:

• d4bcya_ is new in SCOPe 2.02-stable
  
• d4bcya_ appears in SCOPe 2.03
  
• d4bcya_ appears in the current release, SCOPe 2.08