Lineage for d3cara_ (3car A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 157026Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 157027Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 157028Family a.138.1.1: Cytochrome c3-like [48696] (3 proteins)
  6. 157029Protein Cytochrome c3 [48697] (6 species)
  7. 157032Species Desulfovibrio africanus [TaxId:873] [48701] (2 PDB entries)
  8. 157034Domain d3cara_: 3car A: [19662]

Details for d3cara_

PDB Entry: 3car (more details), 1.9 Å

PDB Description: reduced structure of the acidic cytochrome c3 from desulfovibrio africanus

SCOP Domain Sequences for d3cara_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cara_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio africanus}
edmthvptdafgklerpaavfnhdehnekagiescnachhvwvngvlaededsvgtpcsd
chaleqdgdtpglqdayhqqcwgchekqakgpvmcgechvkn

SCOP Domain Coordinates for d3cara_:

Click to download the PDB-style file with coordinates for d3cara_.
(The format of our PDB-style files is described here.)

Timeline for d3cara_: