SCOPe 2.05: Domain d1qn0a_: 1qn0 A:

Lineage for d1qn0a_ (1qn0 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein Cytochrome c3 [48697] (7 species)
   contains four heme groups

7. Species Desulfovibrio gigas [TaxId:879] [48700] (3 PDB entries)

8. Domain d1qn0a_: 1qn0 A: [19659]
   complexed with hec

Details for d1qn0a_

PDB Entry: 1qn0

PDB Description: solution structure of desulfovibrio gigas ferrocytochrome c3, nmr, 20 structures

PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d1qn0a_:

Sequence; same for both SEQRES and ATOM records:

>d1qn0a_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio gigas [TaxId: 879]}
vdvpadgakidfiaggeknltvvfnhsthkdvkcddchhqpgdkqyagcttdgchnildk
adksvnswykvvhdakggakptcischkdkagddkelkkkltgckgsachps

Timeline for d1qn0a_:

• d1qn0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qn0a_ appears in SCOPe 2.04
  
• d1qn0a_ appears in SCOPe 2.06
  
• d1qn0a_ appears in the current release, SCOPe 2.08