Lineage for d3ga1b_ (3ga1 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1202046Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1202047Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1202163Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 1202164Protein automated matches [190710] (2 species)
    not a true protein
  7. 1202165Species Human (Homo sapiens) [TaxId:9606] [187857] (13 PDB entries)
  8. 1202176Domain d3ga1b_: 3ga1 B: [196571]
    automated match to d3m52a_
    complexed with no3

Details for d3ga1b_

PDB Entry: 3ga1 (more details), 2.1 Å

PDB Description: crystal structure of the human nac1 poz domain
PDB Compounds: (B:) Nucleus accumbens-associated protein 1

SCOPe Domain Sequences for d3ga1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ga1b_ d.42.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqtlqmeipnfgnsileclneqrlqglycdvsvvvkghafkahravlaasssyfrdlfnn
srsavvelpaavqpqsfqqilsfcytgrlsmnvgdqdllmytagflqiqeimekgteffl
kv

SCOPe Domain Coordinates for d3ga1b_:

Click to download the PDB-style file with coordinates for d3ga1b_.
(The format of our PDB-style files is described here.)

Timeline for d3ga1b_: