![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (48 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries) |
![]() | Domain d3i9sd_: 3i9s D: [196547] Other proteins in same PDB: d3i9sb2 automated match to d2fe7b_ complexed with cl, so4 |
PDB Entry: 3i9s (more details), 2.2 Å
SCOPe Domain Sequences for d3i9sd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i9sd_ d.108.1.0 (D:) automated matches {Vibrio cholerae [TaxId: 666]} veikrvdkhhcldlvgifieleryyfgdkaaseqdlanylshqvfsehsgvkviaavehd kvlgfatytimfpapklsgqmymkdlfvsssargkgiglqlmkhlatiaithncqrldwt aestnptagkfyksigaslirekeyyrfegnglnklaksl
Timeline for d3i9sd_:
![]() Domains from other chains: (mouse over for more information) d3i9sa_, d3i9sb1, d3i9sb2, d3i9sc_ |