Lineage for d3jusa_ (3jus A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005663Domain d3jusa_: 3jus A: [196472]
    automated match to d3l4db_
    complexed with bcd, ecl, ecn, hem

Details for d3jusa_

PDB Entry: 3jus (more details), 2.9 Å

PDB Description: Crystal structure of human lanosterol 14alpha-demethylase (CYP51) in complex with econazole
PDB Compounds: (A:) Lanosterol 14-alpha demethylase

SCOPe Domain Sequences for d3jusa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jusa_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vksppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
yfptvnyttmihtpenpvirykrrs

SCOPe Domain Coordinates for d3jusa_:

Click to download the PDB-style file with coordinates for d3jusa_.
(The format of our PDB-style files is described here.)

Timeline for d3jusa_: