SCOPe 2.03: Domain d2wpbd_: 2wpb D:

Lineage for d2wpbd_ (2wpb D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (17 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189174] (6 PDB entries)

8. Domain d2wpbd_: 2wpb D: [196428]
   automated match to d2wnqa_
   complexed with zzi; mutant

Details for d2wpbd_

PDB Entry: 2wpb, 2.05 Å

PDB Description: crystal structure of the e192n mutant of e. coli n-acetylneuraminic acid lyase in complex with pyruvate and the inhibitor (2r,3r)-2,3,4-trihydroxy-n,n-dipropylbutanamide in space group p21 crystal form i

PDB Compounds: (D:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d2wpbd_:

Sequence; same for both SEQRES and ATOM records:

>d2wpbd_ c.1.10.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
atnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereq
vleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdh
yraiidsadglpmvvynipalsgvkltldqintlvtlpgvgalxqtsgdlyqmeqirreh
pdlvlyngydnifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnk
vidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqer

Timeline for d2wpbd_:

• d2wpbd_ first appeared in SCOPe 2.02
  
• d2wpbd_ appears in SCOPe 2.04
  
• d2wpbd_ appears in the current release, SCOPe 2.08