Lineage for d2wpbd_ (2wpb D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835078Species Escherichia coli [TaxId:562] [189174] (10 PDB entries)
  8. 2835104Domain d2wpbd_: 2wpb D: [196428]
    Other proteins in same PDB: d2wpba2
    automated match to d2wnqa_
    complexed with zzi; mutant

Details for d2wpbd_

PDB Entry: 2wpb (more details), 2.05 Å

PDB Description: crystal structure of the e192n mutant of e. coli n-acetylneuraminic acid lyase in complex with pyruvate and the inhibitor (2r,3r)-2,3,4-trihydroxy-n,n-dipropylbutanamide in space group p21 crystal form i
PDB Compounds: (D:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d2wpbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wpbd_ c.1.10.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
atnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereq
vleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdh
yraiidsadglpmvvynipalsgvkltldqintlvtlpgvgalxqtsgdlyqmeqirreh
pdlvlyngydnifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnk
vidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqer

SCOPe Domain Coordinates for d2wpbd_:

Click to download the PDB-style file with coordinates for d2wpbd_.
(The format of our PDB-style files is described here.)

Timeline for d2wpbd_: