Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (28 species) not a true protein |
Species Escherichia coli [TaxId:562] [189174] (10 PDB entries) |
Domain d2wpbd_: 2wpb D: [196428] Other proteins in same PDB: d2wpba2 automated match to d2wnqa_ complexed with zzi; mutant |
PDB Entry: 2wpb (more details), 2.05 Å
SCOPe Domain Sequences for d2wpbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wpbd_ c.1.10.1 (D:) automated matches {Escherichia coli [TaxId: 562]} atnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereq vleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdh yraiidsadglpmvvynipalsgvkltldqintlvtlpgvgalxqtsgdlyqmeqirreh pdlvlyngydnifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnk vidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqer
Timeline for d2wpbd_:
View in 3D Domains from other chains: (mouse over for more information) d2wpba1, d2wpba2, d2wpbb_, d2wpbc_ |