SCOP 1.69: Domain d1b9yb_: 1b9y B:

Lineage for d1b9yb_ (1b9y B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (9 PDB entries)

8. Domain d1b9yb_: 1b9y B: [19637]
   Other proteins in same PDB: d1b9ya_, d1b9yc_

Details for d1b9yb_

PDB Entry: 1b9y, 3 Å

PDB Description: structural analysis of phosducin and its phosphorylation-regulated interaction with transducin beta-gamma

SCOP Domain Sequences for d1b9yb_:

Sequence; same for both SEQRES and ATOM records:

>d1b9yb_ a.137.3.1 (B:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus)}
mpviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfkelk

Timeline for d1b9yb_:

• d1b9yb_ first appeared (with stable ids) in SCOP 1.55
  
• d1b9yb_ appears in SCOP 1.67
  
• d1b9yb_ appears in SCOP 1.71
  
• d1b9yb_ appears in the current release, SCOPe 2.08