SCOP 1.69: Domain d1b9ya_: 1b9y A:

Lineage for d1b9ya_ (1b9y A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (13 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (2 families)
   also contains 8-bladed propellers

5. Family b.69.4.1: WD40-repeat [50979] (8 proteins)
   this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain

6. Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50981] (9 PDB entries)

8. Domain d1b9ya_: 1b9y A: [27656]
   Other proteins in same PDB: d1b9yb_, d1b9yc_

Details for d1b9ya_

PDB Entry: 1b9y, 3 Å

PDB Description: structural analysis of phosducin and its phosphorylation-regulated interaction with transducin beta-gamma

SCOP Domain Sequences for d1b9ya_:

Sequence; same for both SEQRES and ATOM records:

>d1b9ya_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus)}
mseldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiya
mhwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldni
csiynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttf
tghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngna
fatgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdal
kadragvlaghdnrvsclgvtddgmavatgswdsflkiwn

Timeline for d1b9ya_:

• d1b9ya_ first appeared (with stable ids) in SCOP 1.55
  
• d1b9ya_ appears in SCOP 1.67
  
• d1b9ya_ appears in SCOP 1.71
  
• d1b9ya_ appears in the current release, SCOPe 2.08