![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (13 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (2 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.1: WD40-repeat [50979] (8 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
![]() | Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50981] (9 PDB entries) |
![]() | Domain d1b9ya_: 1b9y A: [27656] Other proteins in same PDB: d1b9yb_, d1b9yc_ |
PDB Entry: 1b9y (more details), 3 Å
SCOP Domain Sequences for d1b9ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b9ya_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus)} mseldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiya mhwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldni csiynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttf tghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngna fatgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdal kadragvlaghdnrvsclgvtddgmavatgswdsflkiwn
Timeline for d1b9ya_: