Lineage for d2trcg_ (2trc G:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1099677Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1099771Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
  5. 1099772Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)
  6. 1099773Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 1099774Species Cow (Bos taurus) [TaxId:9913] [48673] (18 PDB entries)
  8. 1099780Domain d2trcg_: 2trc G: [19634]
    Other proteins in same PDB: d2trcb_, d2trcp_
    complexed with gd

Details for d2trcg_

PDB Entry: 2trc (more details), 2.4 Å

PDB Description: phosducin/transducin beta-gamma complex
PDB Compounds: (G:) transducin

SCOPe Domain Sequences for d2trcg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2trcg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
mpviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfkelk

SCOPe Domain Coordinates for d2trcg_:

Click to download the PDB-style file with coordinates for d2trcg_.
(The format of our PDB-style files is described here.)

Timeline for d2trcg_: