Lineage for d3qhya_ (3qhy A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450662Protein automated matches [190161] (19 species)
    not a true protein
  7. 1450663Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [196311] (1 PDB entry)
  8. 1450664Domain d3qhya_: 3qhy A: [196312]
    Other proteins in same PDB: d3qhyb_
    automated match to d2x71a_

Details for d3qhya_

PDB Entry: 3qhy (more details), 2.06 Å

PDB Description: Structural, thermodynamic and kinetic analysis of the picomolar binding affinity interaction of the beta-lactamase inhibitor protein-II (BLIP-II) with class A beta-lactamases
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3qhya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qhya_ e.3.1.1 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
thkefsqlekkfdarlgvyaidtgtnqtiayrpnerfafastykalaagvllqqnstkkl
devitytkedlvdyspvtekhvdtgmtlgeiaeaavrysdntagnilfhkiggpkgyeka
lrqmgdrvtmsdrfetelneaipgdirdtstakaiatnlkaftagnalpnhkrniltkwm
kgnatgdkliragvptnwvvadksgagsygtrndiaivwppnrapiiiailsskdekgat
ydnqliaeaaevivnafr

SCOPe Domain Coordinates for d3qhya_:

Click to download the PDB-style file with coordinates for d3qhya_.
(The format of our PDB-style files is described here.)

Timeline for d3qhya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3qhyb_