SCOPe 2.08: Domain d3qhya_: 3qhy A:

Lineage for d3qhya_ (3qhy A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [196311] (1 PDB entry)

8. Domain d3qhya_: 3qhy A: [196312]
   Other proteins in same PDB: d3qhyb_
   automated match to d2x71a_

Details for d3qhya_

PDB Entry: 3qhy, 2.06 Å

PDB Description: Structural, thermodynamic and kinetic analysis of the picomolar binding affinity interaction of the beta-lactamase inhibitor protein-II (BLIP-II) with class A beta-lactamases

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3qhya_:

Sequence; same for both SEQRES and ATOM records:

>d3qhya_ e.3.1.1 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
thkefsqlekkfdarlgvyaidtgtnqtiayrpnerfafastykalaagvllqqnstkkl
devitytkedlvdyspvtekhvdtgmtlgeiaeaavrysdntagnilfhkiggpkgyeka
lrqmgdrvtmsdrfetelneaipgdirdtstakaiatnlkaftagnalpnhkrniltkwm
kgnatgdkliragvptnwvvadksgagsygtrndiaivwppnrapiiiailsskdekgat
ydnqliaeaaevivnafr

Timeline for d3qhya_:

• d3qhya_ first appeared in SCOPe 2.02
  
• d3qhya_ appears in SCOPe 2.07