Lineage for d3qfbd1 (3qfb D:2-105)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484065Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2484376Protein automated matches [190442] (14 species)
    not a true protein
  7. 2484419Species Human (Homo sapiens) [TaxId:9606] [189547] (7 PDB entries)
  8. 2484429Domain d3qfbd1: 3qfb D:2-105 [196293]
    Other proteins in same PDB: d3qfbc2, d3qfbd2
    automated match to d3e3ea_
    complexed with fad, gol

Details for d3qfbd1

PDB Entry: 3qfb (more details), 2.6 Å

PDB Description: Crystal structure of the human thioredoxin reductase-thioredoxin complex
PDB Compounds: (D:) thioredoxin

SCOPe Domain Sequences for d3qfbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qfbd1 c.47.1.1 (D:2-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkqiesktafqealdaagdklvvvdfsatwcgpskmikpffhslsekysnviflevdvdd
cqdvasecevksmptfqffkkgqkvgefsgankekleatinelv

SCOPe Domain Coordinates for d3qfbd1:

Click to download the PDB-style file with coordinates for d3qfbd1.
(The format of our PDB-style files is described here.)

Timeline for d3qfbd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qfbd2