SCOPe 2.01: Domain d1gotg_: 1got G:

Lineage for d1gotg_ (1got G:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (17 PDB entries)

8. Domain d1gotg_: 1got G: [19629]
   Other proteins in same PDB: d1gota1, d1gota2, d1gotb_
   complexed with gdp

Details for d1gotg_

PDB Entry: 1got, 2 Å

PDB Description: heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits

PDB Compounds: (G:) gt-gamma

SCOPe Domain Sequences for d1gotg_:

Sequence; same for both SEQRES and ATOM records:

>d1gotg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
ltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedknpfke

Timeline for d1gotg_:

• d1gotg_ first appeared (with stable ids) in SCOP 1.55
  
• d1gotg_ appears in SCOP 1.75
  
• d1gotg_ appears in SCOPe 2.02
  
• d1gotg_ appears in the current release, SCOPe 2.08