SCOPe 2.04: Domain d3p57j_: 3p57 J:

Lineage for d3p57j_ (3p57 J:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.88: SRF-like [55454] (1 superfamily)
   alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet

4. Superfamily d.88.1: SRF-like [55455] (1 family)

5. Family d.88.1.1: SRF-like [55456] (5 proteins)

6. Protein automated matches [191130] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189221] (3 PDB entries)

8. Domain d3p57j_: 3p57 J: [196251]
   automated match to d3kova_
   protein/DNA complex; complexed with zn

Details for d3p57j_

PDB Entry: 3p57, 2.19 Å

PDB Description: crystal structure of the p300 taz2 domain bound to mef2 on dna

PDB Compounds: (J:) myocyte-specific enhancer factor 2a

SCOPe Domain Sequences for d3p57j_:

Sequence; same for both SEQRES and ATOM records:

>d3p57j_ d.88.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkyteynephesrtnsdivealnkk

Timeline for d3p57j_:

• d3p57j_ first appeared in SCOPe 2.02
  
• d3p57j_ appears in SCOPe 2.03
  
• d3p57j_ appears in SCOPe 2.05
  
• d3p57j_ appears in the current release, SCOPe 2.08