SCOP 1.59: Domain d4aahb_: 4aah B:

Lineage for d4aahb_ (4aah B:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies)

4. Superfamily a.137.2: Quinoprotein alcohol dehydrogenase [48666] (1 family)

5. Family a.137.2.1: Quinoprotein alcohol dehydrogenase [48667] (1 protein)

6. Protein Methanol dehydrogenase, light chain [48668] (2 species)

7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (2 PDB entries)

8. Domain d4aahb_: 4aah B: [19625]
   Other proteins in same PDB: d4aaha_, d4aahc_

Details for d4aahb_

PDB Entry: 4aah, 2.4 Å

PDB Description: methanol dehydrogenase from methylophilus w3a1

SCOP Domain Sequences for d4aahb_:

Sequence; same for both SEQRES and ATOM records:

>d4aahb_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1}
ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
sgnfvfdvk

Timeline for d4aahb_:

• d4aahb_ first appeared (with stable ids) in SCOP 1.55
  
• d4aahb_ appears in SCOP 1.57
  
• d4aahb_ appears in SCOP 1.61
  
• d4aahb_ appears in the current release, SCOPe 2.08