Lineage for d3taub_ (3tau B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1166517Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1166518Protein automated matches [190123] (28 species)
    not a true protein
  7. 1166595Species Listeria monocytogenes [TaxId:1639] [196210] (1 PDB entry)
  8. 1166596Domain d3taub_: 3tau B: [196211]
    automated match to d2j41d_
    complexed with na, so4

Details for d3taub_

PDB Entry: 3tau (more details), 2.05 Å

PDB Description: Crystal Structure of a Putative Guanylate Monophosphaste Kinase from Listeria monocytogenes EGD-e
PDB Compounds: (B:) Guanylate kinase

SCOPe Domain Sequences for d3taub_:

Sequence, based on SEQRES records: (download)

>d3taub_ c.37.1.0 (B:) automated matches {Listeria monocytogenes [TaxId: 1639]}
rgllivlsgpsgvgkgtvreavfkdpetsfdysismttrlpregeqdgvdyyfrsrevfe
qaikdgkmleyaeyvgnyygtpleyveeklaagvdifleievqgamqvrkampegififl
tppdlselknriigrgtesmevveermetakkeiemmasydyavvndvvanavqkikgiv
etehlktervihrykkmle

Sequence, based on observed residues (ATOM records): (download)

>d3taub_ c.37.1.0 (B:) automated matches {Listeria monocytogenes [TaxId: 1639]}
rgllivlsgpsgvgkgtvreavfkdpetsfdysismttrlpregeqdgvdyyfrsrevfe
qaikdgkmleyaeyvgnyygtpleyveeklaagvdifleievqgamqvrkampegififl
tppdlseeermetakkeiemmasydyavvndvvanavqkikgivetehlktervihrykk
mle

SCOPe Domain Coordinates for d3taub_:

Click to download the PDB-style file with coordinates for d3taub_.
(The format of our PDB-style files is described here.)

Timeline for d3taub_: