Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (34 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:1462] [189526] (16 PDB entries) |
Domain d3orwb_: 3orw B: [196165] automated match to d3ojga_ complexed with co |
PDB Entry: 3orw (more details), 2.4 Å
SCOPe Domain Sequences for d3orwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3orwb_ c.1.9.0 (B:) automated matches {Geobacillus kaustophilus [TaxId: 1462]} emvetvcgpvpveqlgktlihehflfgypgfqgdvtrgtfredeslrvaveaaekmkrhg iqtvvdptpndcgrnpaflrrvaeetglniicatgyyyegegappyfqfrrllgtaeddi ydmfmaeltegiadtgikagviklasskgriteyekmffraaaraqketgaviithtqeg tmgpeqaayllehgadpkkivighmcgntdpdyhrktlaygvyiafdrfgiqgmvgaptd eervrtllallrdgyekqimlshdtvnvwlgrpftlpepfaemmknwhvehlfvniipal knegirdevleqmfignpaalfsa
Timeline for d3orwb_: